PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G1843
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 141aa    MW: 16788.8 Da    PI: 9.5729
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G1843genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.21.8e-1356106555
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                  ++ rr+ +NRe+ArrsR RK++ +e+ +++v  L+ eN++Lk++l++  ++
  Gh_A05G1843  56 RKKRRMKSNRESARRSRWRKRMHLENITDEVNRLSVENQQLKNRLSTVINQ 106
                  67889999**********************************999887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.2E-1252103No hitNo description
SMARTSM003381.6E-1452123IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.92154117IPR004827Basic-leucine zipper domain
PfamPF001702.1E-1156106IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-1156108No hitNo description
CDDcd147028.11E-1457108No hitNo description
PROSITE patternPS0003605974IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MFLSQEADQF QLPVNETGFT REELEELLSF LKSNEPVSPN SGSEGSTRAV YSPDERKKRR  60
MKSNRESARR SRWRKRMHLE NITDEVNRLS VENQQLKNRL STVINQYHIV WRENEQLRSE  120
SEALWAKLLD LYWTLATMQS R
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15661KKRRMK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012445431.17e-98PREDICTED: regulatory protein opaque-2-like
TrEMBLA0A0D2URX38e-98A0A0D2URX3_G
STRINGPOPTR_0014s01390.15e-50(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122322432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59530.11e-17basic leucine-zipper 4